PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang01g05260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 423aa    MW: 47006 Da    PI: 8.4703
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang01g05260.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-1660104147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r rWT eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
   Vang01g05260.1  60 RERWTDEEHKKFLEALKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 104
                      78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.03E-1754108IPR009057Homeodomain-like
PROSITE profilePS5129420.88555109IPR017930Myb domain
TIGRFAMsTIGR015571.0E-1658107IPR006447Myb domain, plants
SMARTSM007174.7E-1359107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-960100IPR009057Homeodomain-like
PfamPF002491.2E-1360103IPR001005SANT/Myb domain
CDDcd001674.23E-1062105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MAIQGKNAFT RSRGGPPIGD EICLSPGVHS VADISLHDQF SCGNDYALKV RKPYTITKQR  60
ERWTDEEHKK FLEALKLYGR AWRRIEEHVG TKTAVQIRSH AQKFFSKIVR ETSGNSTALE  120
ESIEIPPPRP KRKPIHPYPR KLIEIPKKEI FNSEHPLRSI SLKSSDFGQE NNSPKSVLST  180
VVSENLGSSD SDTPTGSLSP VSSISGVLTN RFPLAQPKTS FEEEGSLPSS AHDEQHLVKL  240
KLFHKETVST KDDAAEESCG RTLKLFGTTL LVTDTSKPFS LITEPFKPIP AAVTYLMQLQ  300
NGCSDLAESP ASIVPRWTFS HNALSVPLHR ELKGKHLYSN LGDFEHKEVQ KEGSWTGSNT  360
SSVNDGDNTA PSETSGIFEL RVRAKTCGKG FVPYKRCMAE RENKYSSVCD EEREEQRVKP  420
SL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502591.10.0PREDICTED: protein REVEILLE 1
TrEMBLA0A0S3RL940.0A0A0S3RL94_PHAAN; Uncharacterized protein
STRINGGLYMA14G39130.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29563372
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.11e-63MYB_related family protein